SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003073370.1.23661 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003073370.1.23661
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily SRP19 5.62e-26
Family SRP19 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003073370.1.23661
Sequence length 137
Comment signal recognition particle Srp19 [Encephalitozoon intestinalis ATCC 50506]; AA=GCF_000146465.1; RF=representative genome; TAX=876142; STAX=58839; NAME=Encephalitozoon intestinalis ATCC 50506; strain=ATCC 50506; AL=Chromosome; RT=Major
Sequence
MENKYFCLYPAYMDSSRALSEGRKYRKEICIEKPRYHEIKNALEKLEIECVEEPLKKHPR
DFFNNGRFRIKKEYGKLFVVEGVSQTIAEMRSSARSGGSVSSGKQAHGKVVHGVVQKGVY
VENKLNLVRKKKTKKKK
Download sequence
Identical sequences E0S8L6
XP_003073370.1.23661 ubc|Ein08_0760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]