SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003093081.1.11157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003093081.1.11157
Domain Number 1 Region: 140-263
Classification Level Classification E-value
Superfamily EF-hand 2.23e-39
Family Osteonectin 0.00038
Further Details:      
 
Domain Number 2 Region: 74-136
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000265
Family Ovomucoid domain III-like 0.0023
Further Details:      
 
Weak hits

Sequence:  XP_003093081.1.11157
Domain Number - Region: 51-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0644
Family Follistatin (FS) module N-terminal domain, FS-N 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003093081.1.11157
Sequence length 264
Comment CRE-OST-1 protein [Caenorhabditis remanei]; AA=GCF_000149515.1; RF=representative genome; TAX=31234; STAX=31234; NAME=Caenorhabditis remanei; strain=PB4641; AL=Scaffold; RT=Major
Sequence
MRYALVACLLLLAATAFVDAKKKKVADDELGELLDNIDADEEKKSVEPAKNPCEDHQCGW
GKECVVGKKGEPTCECISKCPELDGDPMDKVCANNNQTFTSLCDLYRERCLCKRKSKECE
KATNAKVHLEYLGECKKLDECTEEHMAQFPERMADWLFQVMKELKKRRELHKLEWEELLS
EAENDDEKKHVYPVIWKFCELDTKPHDKSVSHHELIPITAPVIPMESCIKPFLEGCDANN
DGNISIKEWGKCLGLKEGEIQERC
Download sequence
Identical sequences A0A261BHN1 E3NES9
XP_003093081.1.11157 31234.CRE10644 CRE10644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]