SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003204821.1.16129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003204821.1.16129
Domain Number 1 Region: 6-93
Classification Level Classification E-value
Superfamily E set domains 8.82e-17
Family Other IPT/TIG domains 0.00000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003204821.1.16129
Sequence length 925
Comment PREDICTED: exocyst complex component 2 [Meleagris gallopavo]; AA=GCF_000146605.2; RF=representative genome; TAX=9103; STAX=9103; NAME=Meleagris gallopavo; breed=Aviagen turkey brand Nicholas breeding stock; AL=Chromosome; RT=Major
Sequence
MSRARQPPLVTGISPNEGISWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKI
VCRVGQAKNDKGDIIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDR
NKGIPPLSLRPANPLGIEIDKGRFPQKDLEMLFPGMSADFTSENFSAAWYLIENHSTTSF
DQLKMAVVHLKKQANKKSEGSLAYVKGGLSTFFEAQDALSAIHQKLEADGTEKVEGSMTQ
KLENVLNRASNTADTLFQEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIERNIQKGDYD
VVINDYEKAKSLFGKTEVQVFKKYYAEVETRIEALRELLLDKLLETPSTLHDQKRYIRYL
SDLHAPGDPAWQCIGAQHQWILQLMHNCKESYVKEQKGTSLLHSSMLDLDSDVRPSPIGH
LSQTASLKRGSSFQSGRNDAWRYKAPQQVVFVEKLTKLVVSQLPNFWKLWISYVNGSLFS
ETAEKSGQMEKSKKNARQRQNDFKKMIQEVMHSLEKLIRGALLPFSLKEGESRQYGGWEM
KSELSGQWLTHVIQTVRLSSESLTALEIPNDMLQIIQDLILDLRVRCIIVTLQHTAEDIK
RLAEKEDWVVDNEGLTSLPSHFEQCIVHSLQSLKTVLDCKPGEASVFQQQKIQEDVCQLS
IGILQVFIDCLEQLSTKPDGDIDTSHLSVDVSSPDLFGSIHEDSSLTSEQRVLIALSNCR
YLERHTFLNIAEHFEKHGFQGVDKITQVSMESLKELDQRLFEMYIESKADPIVGSLEPGI
YAGYFDWKDCLVPAGVRNYLKEALVNIIAVHAEVFTISKDLVPRVMSKIVEAVSEELSRL
MQCVSSFSKNGALQARLEICALKDTVAIYLTPDSNSSFKQALEALPQISSGADKKLLEEL
LNKFKSSMHLQLTCFQTSSSAMIKT
Download sequence
Identical sequences G1MZ48
ENSMGAP00000004283 ENSMGAP00000004283 XP_003204821.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]