SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003220230.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003220230.1.98722
Domain Number 1 Region: 32-61,179-349
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.6e-63
Family G proteins 0.0000000208
Further Details:      
 
Domain Number 2 Region: 61-181
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 4.06e-43
Family Transducin (alpha subunit), insertion domain 0.000000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003220230.1.98722
Sequence length 354
Comment PREDICTED: guanine nucleotide-binding protein G(k) subunit alpha [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MGCTLSAEDKAAVERSRMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEVARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDPGVQACFSRSREYQLNDSASYYLNDLERISQQNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRRSPLTICYPEYPGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
Download sequence
Identical sequences G1KKZ4
ENSACAP00000010978 ENSACAP00000010978 XP_003220230.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]