SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003265121.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003265121.1.23891
Domain Number 1 Region: 310-463
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.67e-43
Family Dual specificity phosphatase-like 0.0000599
Further Details:      
 
Domain Number 2 Region: 141-286
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.98e-24
Family Cell cycle control phosphatase, catalytic domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003265121.1.23891
Sequence length 482
Comment PREDICTED: dual specificity protein phosphatase 10 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MPPSPLDDRVVVALSRPVRPQDLNLCLDSGYLGSAAPGSNSHPPVIATTVVSLKAANLTY
MPSSSGSARSLNCGCSSASCCTVATYDKDNQAQTQAIAAGTTTTAIGTSTTCPANQMVNN
NENTGSLSPSSGVGSPVSGTPKQLASIKIIYPNDLAKKMTKCSKSHLPSQGPVIIDCRPF
MEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENT
NEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQECREVGGGA
SAASSLLPQPIPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGYIINVTTHLPL
YHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVI
AYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVET
VV
Download sequence
Identical sequences A0A2I3HVQ2
ENSNLEP00000016685 XP_003265121.1.23891 ENSNLEP00000016685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]