SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003266656.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003266656.1.23891
Domain Number 1 Region: 33-95
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000998
Family Ovomucoid domain III-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003266656.1.23891
Sequence length 96
Comment PREDICTED: serine protease inhibitor Kazal-type 13 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MKWLPFPHKIIFFLVCSTLTHVAFSGIFKRRDFTRWPKPRCKMYIPLDPDYDADCPNVTA
PVCASNGRTFQNECFFCVEQREFHYRIKFEKYGKCD
Download sequence
Identical sequences XP_003266656.1.23891 ENSNLEP00000012276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]