SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003271068.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003271068.1.23891
Domain Number 1 Region: 13-319,423-463
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.63e-76
Family FAD-linked reductases, N-terminal domain 0.000000000762
Further Details:      
 
Domain Number 2 Region: 299-409
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.24e-36
Family L-aminoacid/polyamine oxidase 0.000000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003271068.1.23891
Sequence length 527
Comment PREDICTED: amine oxidase [flavin-containing] A isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTVRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVCERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPADAPWEAQHADEWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPNLTAKIHFRPELPADRNQLIQRLPM
GAIIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLPKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Download sequence
Identical sequences A0A2I3HIJ8
ENSNLEP00000002873 XP_003271068.1.23891 ENSNLEP00000002873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]