SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003271888.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003271888.1.23891
Domain Number 1 Region: 223-608
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.63e-157
Family Myotubularin-like phosphatases 0.000000000011
Further Details:      
 
Domain Number 2 Region: 100-221
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-41
Family GRAM domain 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003271888.1.23891
Sequence length 667
Comment PREDICTED: myotubularin-related protein 1 isoform X3 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MDRPAAAAVAAAGCEGGGGPNPGPAGGRRPPRAAGGATAGSRQPSVETLDSPTGSHVEWC
KQLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKDVMYICP
FMGAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVISRVEKIGAQSHGDNSCGIEIVCKD
MRNLRLAYKQEEQSKLGIFENLNKHAFPLSNGQALFAFSYKEKFPINGWKVYDPVSEYKR
QGLPNESWKISKINSNYEFCDTYPAIIVVPTSVKDDDLSKVAAFRAKGRVPVLSWIHPES
QATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNKTKGGGY
ESESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSNVDGTHWLEYIRMLLA
GAVRIADKIESGKTSVVVHCSDGWDRTAQLTSLAMLMLDSYYRTIKGFETLVEKEWISFG
HRFALRVGHGNDNHADADRSPIFLQFIDCVWQMTRQFPSAFEFNELFLITILDHLYSCLF
GTFLCNCEQQRFKEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWV
NYYVRWNPRMRPQMPIHQNLKELLAVRAELQKRVEGLQREVATRAVSSSSERGSSPSHSA
ASVHTSV
Download sequence
Identical sequences M3ZCF4
ENSNLEP00000016504 XP_003271888.1.23891 XP_012354423.1.23891 ENSNLEP00000016504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]