SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003281233.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003281233.1.23891
Domain Number 1 Region: 28-123
Classification Level Classification E-value
Superfamily Snake toxin-like 5.86e-24
Family Extracellular domain of cell surface receptors 0.022
Further Details:      
 
Domain Number 2 Region: 136-225
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000249
Family Extracellular domain of cell surface receptors 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003281233.1.23891
Sequence length 353
Comment PREDICTED: ly6/PLAUR domain-containing protein 3 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MDPARKAGAQAVIWTAGWLLLLLLLRGGAQALECYSCVQKADDGCSPNKMKTVKCAPGVD
VCTEAVGAVEAVHGQFSMAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNL
TSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTL
MAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSHCNSDLRNKTYFSPRIPPLV
RLPPPEPTTVASTISVTSTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEE
PRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGCVAPTAGLAALLLAVAAGVLL
Download sequence
Identical sequences XP_003281233.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]