SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003286904.1.95606 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003286904.1.95606
Domain Number 1 Region: 32-60,182-345
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.8e-46
Family G proteins 0.0000246
Further Details:      
 
Domain Number 2 Region: 72-184
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 7.72e-21
Family Transducin (alpha subunit), insertion domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003286904.1.95606
Sequence length 354
Comment G-protein subunit alpha 12 [Dictyostelium purpureum]; AA=GCF_000190715.1; RF=representative genome; TAX=5786; STAX=5786; NAME=Dictyostelium purpureum; strain=QSDP1; AL=Scaffold; RT=Major
Sequence
MCTRNKKELTTEYLNSKKIDREIRVESSQLQPLKLLLLGSGECGKSTIFKQIISFQDEQT
RKEYTPPSDYVIRNIFLNIVTAMNTFIKVAPSYEIEFSEEENQKIETILRVFDDLETLSQ
STFTSIADNIKYLWNTKQVQTIYNHPKRIYQLNDSTEYLMNNIDRFSKPFKPSQNDYLRV
RVKTTGIVEADFKIEAVPFKLVDVGGQKNQRRKWIHCFQDISAILFVTSINDYDTVLEED
NSTSRFTDSLELFREMVNSGWFTKSPFVVFFNKVDLFKEKIKRIPLSQHLNDFTGNNYSY
EETSQFIKNKFHGTITNQNKIVYHHFTCALDSHAIEVVFNSVQHSLLMNVAEVL
Download sequence
Identical sequences F0ZHL0
jgi|Dicpu1|150924|GID1.0041613 XP_003286904.1.95606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]