SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003306557.1.2082 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003306557.1.2082
Domain Number 1 Region: 78-168
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.25e-20
Family Cold shock DNA-binding domain-like 0.00045
Further Details:      
 
Domain Number 2 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.57e-18
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003306557.1.2082
Sequence length 171
Comment hypothetical protein PTT_19733 [Pyrenophora teres f. teres 0-1]; AA=GCF_000166005.1; RF=representative genome; TAX=861557; STAX=53485; NAME=Pyrenophora teres f. teres 0-1; strain=0-1; AL=Scaffold; RT=Major
Sequence
MFFLKELEKTIQLHPSYFGPLIRQHIHRELLQKEEGSSTGKYTIVCILDSFDISDGKVMP
GTGSAEYVVHYKAVVWRPYKGEVMDGIVTSVLRTGFFVDCGSLQAFVGRSMIPAEIKFDA
NATPPQWTDDGEQVIEKGTNIRIKIKGLRSEVDKMYAVGTMKEDYLGPLPS
Download sequence
Identical sequences B2WC37 E3S9K2
PTRT_07546 XP_001937878.1.10593 XP_003306557.1.2082 EFQ85355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]