SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003316016.2.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003316016.2.37143
Domain Number 1 Region: 102-167
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000416
Family Ovomucoid domain III-like 0.0011
Further Details:      
 
Domain Number 2 Region: 198-243
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000638
Family Ovomucoid domain III-like 0.0062
Further Details:      
 
Domain Number 3 Region: 36-73
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000458
Family TB module/8-cys domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003316016.2.37143
Sequence length 263
Comment PREDICTED: follistatin-related protein 3 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MRPGAPGPLWPLPWGALAWAVGFVSSMGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAE
CCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPRCE
CAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQ
SCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHA
GSCAGTPKEPPDGESAEEEENFV
Download sequence
Identical sequences K7BKW3
XP_003316016.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]