SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003367059.1.5133 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003367059.1.5133
Domain Number 1 Region: 54-82
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000641
Family Somatomedin B domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003367059.1.5133
Sequence length 89
Comment tubulointerstitial nephritis antigen [Trichinella spiralis]; AA=GCF_000181795.1; RF=representative genome; TAX=6334; STAX=6334; NAME=Trichinella spiralis; strain=ISS 195; AL=Scaffold; RT=Major
Sequence
MFYLSNSQEARKAEYVLVPQEHGPESESWNKNTIYQTEANVEDNNDELSFSLPRRNNLCY
CDEACIRLNDCCTDYHSVCPGMNDAFPIF
Download sequence
Identical sequences E5T4K8
EFV48024 XP_003367059.1.5133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]