SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003381264.1.5133 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003381264.1.5133
Domain Number 1 Region: 186-302
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 2.35e-36
Family eIF-2-alpha, C-terminal domain 0.0000104
Further Details:      
 
Domain Number 2 Region: 90-182
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.7e-28
Family eIF2alpha middle domain-like 0.0000953
Further Details:      
 
Domain Number 3 Region: 12-92
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.29e-17
Family Cold shock DNA-binding domain-like 0.0000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003381264.1.5133
Sequence length 343
Comment eukaryotic translation initiation factor 2 subunit 1 [Trichinella spiralis]; AA=GCF_000181795.1; RF=representative genome; TAX=6334; STAX=6334; NAME=Trichinella spiralis; strain=ISS 195; AL=Scaffold; RT=Major
Sequence
MPHLSCRFYADKYPQVEDTVVVTVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSVN
KLIRVGRSECVVVIRVDEDKGYIDLSKRRVYTKDLIECEERFAKAKAVYSILRHVADQLG
YDSDNQLEDLLNRTAWHFDRKYNKKAASYEVFKKAVNDESVLDECDIDDATKEKILENIR
KRLTPQAVRIRADVEVSCFGYDGIDAVKAALSEGLKCSTEEMPIKINLIAPPLYVVTTST
FERTEGLAAVNATLERIRESIESNNGRFRIILAPKVVTDWDEEDIKRKLELLELESAEVP
GDDDDEETEGMVAPAGLDRQYDKEQHNVVREKDEEEEAASDGD
Download sequence
Identical sequences A0A0V0ZW95 E5S7W5
EFV59120 XP_003381264.1.5133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]