SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003677016.1.18554 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003677016.1.18554
Domain Number 1 Region: 48-127
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.000000000392
Family Supernatant protein factor (SPF), C-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003677016.1.18554
Sequence length 214
Comment hypothetical protein NCAS_0F01770 [Naumovozyma castellii CBS 4309]; AA=GCF_000237345.1; RF=representative genome; TAX=1064592; STAX=27288; NAME=Naumovozyma castellii CBS 4309; strain=type strain:CBS 4309; AL=Chromosome; RT=Major
Sequence
MLNFNQLVSLFALFTWHIVEFASASSSSSSYSPMVLSLPAFTTECLYHDILNDEDTLVVS
YQVMTGGNFEIDFEITAPDGSQLVLEKQKKYSDFVLKSFGLGQYTFCFTNSYGTALKKIE
FTLEMEKKLDNSNVNAEDIVASNAIEEIERNLNKITKTLNYLRAREWRNMSTVESTGSRL
VWLSLLVMGVMVGISAVQAFVIQFFFKSRQRNFV
Download sequence
Identical sequences G0VGP0
XP_003677016.1.18554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]