SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003789101.1.62490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003789101.1.62490
Domain Number 1 Region: 1577-1819
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.97e-54
Family Ankyrin repeat 0.00000103
Further Details:      
 
Domain Number 2 Region: 918-1051
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000581
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 3 Region: 478-594
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000154
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 277-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000712
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 768-806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000153
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 6 Region: 589-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000202
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 352-480
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000267
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 104-238
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000691
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 9 Region: 692-729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000876
Family EGF-type module 0.017
Further Details:      
 
Domain Number 10 Region: 1253-1284
Classification Level Classification E-value
Superfamily Notch domain 0.00000017
Family Notch domain 0.0024
Further Details:      
 
Domain Number 11 Region: 809-934
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000022
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 12 Region: 729-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 1047-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000292
Family EGF-type module 0.013
Further Details:      
 
Domain Number 14 Region: 236-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000365
Family EGF-type module 0.045
Further Details:      
 
Domain Number 15 Region: 66-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000205
Family EGF-type module 0.033
Further Details:      
 
Domain Number 16 Region: 314-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family EGF-type module 0.01
Further Details:      
 
Domain Number 17 Region: 1216-1246
Classification Level Classification E-value
Superfamily Notch domain 0.00000915
Family Notch domain 0.0065
Further Details:      
 
Domain Number 18 Region: 31-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000107
Family EGF-type module 0.037
Further Details:      
 
Weak hits

Sequence:  XP_003789101.1.62490
Domain Number - Region: 1134-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000699
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 1089-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00166
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 626-657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 1175-1204
Classification Level Classification E-value
Superfamily Notch domain 0.0102
Family Notch domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003789101.1.62490
Sequence length 2000
Comment PREDICTED: neurogenic locus notch homolog protein 4 [Otolemur garnettii]; AA=GCF_000181295.1; RF=representative genome; TAX=30611; STAX=30611; NAME=Otolemur garnettii; AL=Scaffold; RT=Major
Sequence
MQPPSPLLLLLLLLLLCFSVVMTRGLLCGSFPEPCANGGTCLSLSQGQGACQCAPGFLGE
MCQFPDPCQDAQLCQNGGSCQILPPAPQGSPSPSSHLAPSFFCTCPPGFTGERCQAQLED
PCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQC
RCPPGFEGHACEHDVNECFLDPGPCPKGTSCHNTLGSFQCLCPAGRDGPHCELWAGPCPA
RGCPNGGTCQLVPGADSTFHLCLCPPGFTGPDCQVNQDNCVSHQCQNGGTCQDGLGTYTC
LCPETWTGWDCSRDVDECETQGPTRCRNGGTCQNSAGGFHCVCVSGWGGTGCEENLDDCI
AATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHEAAQCSTNPLTGSTLCLC
QPGYSGPTCHQDLDECQMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECL
SQPCHPGSTCLDLLATFHCLCPPGLEGRLCEVETNECASAPCLNHADCHDLLNGFQCICL
PGFAGTRCEEDINECKSSPCANGGQCQDQPGAFHCECLPGFEGPRCQTEVDECLSGPCPI
GASCLDLPGTFFCLCPSGFTGQLCEVSLCAPNLCQPKQICQDLKDKAHCLCPDGSPGCAP
TEDNCTCHHGHCQRSSCVCDAGWTGPECEAELGGCTSTPCAHGGTCHPQPSGYNCTCPAH
YTGPTCSEEVTVCHSGPCLNGGSCSPSPGGYYCICPPSHTGPHCQTSTDHCASAPCLNGG
TCVNRLGTSSCLCAPGFQGPRCEGRIRPSCADSPCRNRATCQDGPQGPRCLCPPGYTGGS
CQILLDLCAQKPCPHTSRCLQTGPSFQCLCLQGWTGPLCNLPLSPCQEAALSQGIEVSSL
CQNGGLCIDSGPSYFCHCPPGFQGSSCQDKVNPCESRPCQHGATCVAQPNGYLCQCTPGY
SGQNCSKEPDACQSQPCHNQGTCTPKSGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGT
AACHSLANAFYCQCLPGHTGQRCEVEVDPCQSQPCFHGGSCEAIPGPPPGFTCHCPKGFE
GPTCSHRAPSCGLHHCHHGGLCLPSPKPGFLPQCACLSGYRGPDCLTPPAPRGCGPPSPC
LHNGSCSETPGWTGPGFRCSCPPNSPGPQCQRSGEKGCEGRGGDGACDDGCSGPGGNWDG
GDCSLGIPDPWKGCPSHSQCWLLFRDGQCHPQCDSEECLFDGYDCETPPVCTPAYDQYCR
DHFHNGHCEKGCNTAECGWDGGDCRPEDGDSEWGPSLALLVVLSPPALDKQLLALARVLS
LTLRVGLWVRKDSDGRDMVYPYPGARAEEELGGTLDPSHQERAAPQTQSPDKETDSLSAG
FVVVMGVDLSHCDPDHSGSRCPWDPGLLLRFLAAMTAVGALEPLLPGPLLAAHPHAGTAP
PANQLPWPVLGSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPQSQPAPRRR
RPPLGEDSIGLKTLKPEAEVDEDGVVMCAGPEEGEEVGRAEETASPSKLWPLSGNCGELP
QAAMLTPPQESETEAPDLDTRGPDGVTPLMSAVCCGEVESRTFHGAWLGSPEPWEPLLDE
GACPQVHTVGTGETPLHLAARFSRPNAARRLLEAGANPNQPDQAGRTPLHTAVAADAREV
CQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAARADVGARDKWGKTALHWAA
AVNNARAARSLLQAGSDKNAQDSREQTPLFLAAREGAVEVAQLLLDLGAARELRDQAGLA
PGDIARQRNHWDLLTLLEGTGPSVASHKATTSREAEAVPRARTASGSVPPHGGGALPRCR
TLSAGTGPRGGGACLQARTKSVDLATRGGMAYSHCRSLSRGGAGGGPPPRGRRFSTSMRG
PRPSPATARGSRIAAGRGGRASADDWPCDWVSLGTCGPTSSLPIPPPCLTPSPEHGSPQV
VWGSAYYQEIPLNLEEKGQK
Download sequence
Identical sequences H0X260
ENSOGAP00000009118 XP_003789101.1.62490 ENSOGAP00000009118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]