SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003844725.1.65998 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003844725.1.65998
Domain Number 1 Region: 326-447
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.63e-30
Family cAMP-binding domain 0.00033
Further Details:      
 
Domain Number 2 Region: 187-322
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.61e-27
Family cAMP-binding domain 0.0000366
Further Details:      
 
Domain Number 3 Region: 3-40
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000445
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003844725.1.65998
Sequence length 469
Comment similar to cAMP-dependent protein kinase regulatory subunit [Leptosphaeria maculans JN3]; AA=GCF_000230375.1; RF=representative genome; TAX=985895; STAX=5022; NAME=Leptosphaeria maculans JN3; AL=Scaffold; RT=Major
Sequence
MSLPSDYSNEISALDREILKHQPHDILQFCANFFNRRLESQRTEALLSQQHSSPQGRGLA
DNTFPGNNPFSTSPTGGAPAKSPMQRLEEEEENDTMTSPTASSFGTIDFGKPRNTNNNNN
NAHNGTPSAFGDFQGFGGSSKSNITQMPPLAGDGQSFPSNYNTNRRTSVSAESLNPASAA
AGDFTAPFHQKSQDQLSRLRAAVSGNFLFSHLDDDQSSLVLGALHEKPIPTKGIKVISQG
DVGDYFYVVEKGEFDIYVNKSGKVETGQEGIGNKVGSVGPGGSFGELALMYNAPRAATVI
STEASTLWALDRVTFRRILMDSAFQRRRMYEGFLEEVPLLSTLTPYERSKIADALETKKY
PPGSTIIQEGDVGESFYLLESGDAQVFKRGIETAVKEYTKGDYFGELALLNDAPRAASVV
SRTEVKVATLGKNGFQRLLGPVEGIMRRNDPSKPGFTGDHVDPLSRTTG
Download sequence
Identical sequences E5ADF7
CBY01246 XP_003844725.1.65998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]