SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003853180.1.87952 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_003853180.1.87952
Domain Number - Region: 26-76
Classification Level Classification E-value
Superfamily eEF1-gamma domain 0.0196
Family eEF1-gamma domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003853180.1.87952
Sequence length 265
Comment hypothetical protein MYCGRDRAFT_92914 [Zymoseptoria tritici IPO323]; AA=GCF_000219625.1; RF=representative genome; TAX=336722; STAX=1047171; NAME=Zymoseptoria tritici IPO323; strain=IPO323; AL=Chromosome; RT=Major
Sequence
MENSPLERLPQEIRDEIWEYALTQPKPIIITANTSTKALKKDWRSHAPKPVSLLHTCKKI
NNETRLLFYRLNVFTIQLDGTHSMNSSDRINEANITQLFFDAIGPEKTAAIGGFGVLVKH
FHPIGAPRRRDTEIYEHVSGIVFPLRRLVRRLGPNCVVMCHFRWVAYAGGGSRGFEESGA
DWYVNLRDLNQTFDFPVEFGPYWEKFLQALKVGLVHEEMREVTDMSSLALLWPFVIDFMD
FGPPRHIALLDILKLENATTNNSMV
Download sequence
Identical sequences F9X9T1
XP_003853180.1.87952 jgi|Mycgr1|39761|fgenesh2_pg.C_scaffold_5000846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]