SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003941492.1.74449 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003941492.1.74449
Domain Number 1 Region: 27-188
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.15e-47
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 243-286
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000301
Family SOCS box-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003941492.1.74449
Sequence length 288
Comment PREDICTED: ankyrin repeat and SOCS box protein 8 [Saimiri boliviensis boliviensis]; AA=GCF_000235385.1; RF=representative genome; TAX=39432; STAX=27679; NAME=Saimiri boliviensis boliviensis; AL=Scaffold; RT=Major
Sequence
MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCTHGTLKPLHCA
CMVSDADCVELLLEKGAEVNALDGYNRTALHYAAEKDEACVEVLLEYGANPNALDGNRDT
PLHWAAFKNNAECVRALLESGASVNALDYNNDTPLSWAAMKGNLESVSILLDYGAEVRVI
NLIGQTPISRLVALLVRGLGTEKEDSCFELLHRAVGHFELRKNGTMPREVARDQQLCEKL
TVLCSAPGTLKTLARYAVRHSLGLQYLPDAVKGLPLPASLKEYLLLLE
Download sequence
Identical sequences A0A2K5S222 A0A2K6S4N5
XP_003941492.1.74449 XP_010350551.1.74449 XP_017384598.1.71028 XP_017384609.1.71028 XP_017384620.1.71028 XP_017384631.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]