SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003989382.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003989382.1.62641
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 3.79e-23
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0014
Further Details:      
 
Domain Number 2 Region: 79-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000001
Family Cold shock DNA-binding domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003989382.1.62641
Sequence length 204
Comment PREDICTED: DNA-directed RNA polymerase III subunit RPC8 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVF
PGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKF
DEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSAEATSSSEELPKK
EAPYTLVGSISEPGLGLLSWWTSS
Download sequence
Identical sequences M3W6B9 M3YY81
XP_003989382.1.62641 XP_004771298.1.14098 XP_008701168.1.72690 XP_008701169.1.72690 XP_008701170.1.72690 XP_014933350.1.86478 XP_014933351.1.86478 ENSFCAP00000006213 ENSMPUP00000016291 ENSMPUP00000016291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]