SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003997568.2.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003997568.2.62641
Domain Number 1 Region: 88-182
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-30
Family PDZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 9-63
Classification Level Classification E-value
Superfamily L27 domain 2.79e-23
Family L27 domain 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003997568.2.62641
Sequence length 207
Comment PREDICTED: protein lin-7 homolog B [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MAALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDT
LDITGSAEIRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYIS
RVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEE
MEARFEKMRSARRRQQHQSYSSLESRG
Download sequence
Identical sequences A0A0A0MXE5 A0A0D9S348 A0A2K5L6B1 A0A2K5WQT6 A0A2K6CP96 A0A2K6FM17 G1QYI7 G3TBU6 H0UYM4 H0WTW8 H2NZL6 H9EQG1 I3NDK1 K7D105 M3WP58 Q9HAP6
ENSP00000221459 ENSOGAP00000005625 ENSP00000221459 NP_001181578.1.72884 NP_071448.1.87134 NP_071448.1.92137 XP_002829584.1.23681 XP_003269803.1.23891 XP_003465569.1.53824 XP_003801548.1.62490 XP_003997568.2.62641 XP_004089425.1.23891 XP_004271105.1.21590 XP_004867015.1.39548 XP_005336714.1.77405 XP_005589914.1.63531 XP_006868251.1.41390 XP_006898739.1.29581 XP_011372864.1.92234 XP_011766469.1.29376 XP_011936204.1.92194 XP_012498632.1.63892 XP_012609858.1.48125 XP_015978006.1.101085 XP_016791985.1.37143 XP_019281280.1.44245 XP_019597244.1.88060 XP_021536937.1.83697 XP_851922.3.84170 ENSTTRP00000016208 ENSNLEP00000006008 ENSMMUP00000031529 10141.ENSCPOP00000002242 9544.ENSMMUP00000031529 9600.ENSPPYP00000011459 9606.ENSP00000221459 9615.ENSCAFP00000005713 ENSP00000375737 ENSCPOP00000002242 ENSOGAP00000005625 ENSSTOP00000022448 ENSCPOP00000002242 ENSTTRP00000016208 ENSSTOP00000022448 gi|11545920|ref|NP_071448.1| ENSPPYP00000011459 ENSLAFP00000011480 ENSNLEP00000006008 ENSLAFP00000011480 ENSMMUP00000031529 ENSPPYP00000011459 ENSPANP00000015273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]