SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004062098.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004062098.1.27298
Domain Number 1 Region: 26-193
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.91e-37
Family MHC antigen-recognition domain 0.0000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004062098.1.27298
Sequence length 238
Comment PREDICTED: endothelial protein C receptor [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEG
PDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCEL
PPESSRPHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELRE
FLEDTCVQYVQKHTSAENTKGSQTSRSYTSLVLGVLVGSFIIAGVAVGIFLCTGGRRC
Download sequence
Identical sequences G3QFD6
ENSGGOP00000001005 XP_004062098.1.27298 ENSGGOP00000001005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]