SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004205978.1.79663 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_004205978.1.79663
Domain Number - Region: 107-143
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.034
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004205978.1.79663
Sequence length 150
Comment PREDICTED: protein dpy-30 homolog isoform X1 [Hydra vulgaris]; AA=GCF_000004095.1; RF=representative genome; TAX=6087; STAX=6087; NAME=Hydra vulgaris; strain=105; AL=Scaffold; RT=Major
Sequence
MSNEEPMQIADDASANTSADQTPSIQTVEETVADHVNPEVVKDDFAHTVQEPKEDTEPEK
STENTHKATNEEMAELLSEKTKKVVNDEREAATKPKSKVEIQSLPTRQYLDQSIVPILLQ
GLTAIAKERPAEPIDFLAAYLMKNKHLYQS
Download sequence
Identical sequences XP_004205978.1.79663 gi|449664682|ref|XP_004205978.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]