SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004226737.1.78797 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004226737.1.78797
Domain Number 1 Region: 16-98
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000102
Family Snake venom toxins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004226737.1.78797
Sequence length 128
Comment PREDICTED: uncharacterized protein LOC101242363 [Ciona intestinalis]; AA=GCF_000224145.2; RF=representative genome; TAX=7719; STAX=7719; NAME=Ciona intestinalis; AL=Chromosome; RT=Major
Sequence
MFLKILFLALSLISVGDALKCYNCSSSFPSDQECLKPTTNRYALTCANNQSHCVKITLKT
GSLETVERRCGSQQLNTCLNVIITACSHSCSTDLCNSATKPHVDLRFLSALMIGWVVILS
SSSALLTK
Download sequence
Identical sequences F7A7S2
ENSCINP00000025756 ENSCINP00000025756 XP_004226737.1.78797 7719.ENSCINP00000025756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]