SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004265330.1.21590 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004265330.1.21590
Domain Number 1 Region: 23-112
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000635
Family Snake venom toxins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004265330.1.21590
Sequence length 140
Comment PREDICTED: lymphocyte antigen 6H [Orcinus orca]; AA=GCF_000331955.2; RF=representative genome; TAX=9733; STAX=9733; NAME=Orcinus orca; AL=Scaffold; RT=Major
Sequence
MLPAAMKGLGLVLLAALLCSGPAHGLWCQDCTLTTNSSHCTPKQCPPADTVCASVRITDP
SSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGVALAGHSS
WALAGGLLLGLGPTLLWAGP
Download sequence
Identical sequences XP_004265330.1.21590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]