SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004273795.1.21590 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004273795.1.21590
Domain Number 1 Region: 6-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000889
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004273795.1.21590
Sequence length 221
Comment PREDICTED: calcium-binding tyrosine phosphorylation-regulated protein isoform X4 [Orcinus orca]; AA=GCF_000331955.2; RF=representative genome; TAX=9733; STAX=9733; NAME=Orcinus orca; AL=Scaffold; RT=Major
Sequence
MISARPRLVVPYGLKTLLEGVSRAILKTNPPNITQFAAVYFKELIVFREGNNSLDVKDLV
KLFHQIKGEKWSEGMAQEKKPECVKEPERTSTVSQEPKRMEKSTDTEEDNITAPQFSNKT
TQFPSVHAELFSEPEGAPEAARAPSKPTAPENATPASPPSPAAVSPELAYVPADPAQFAV
QMLEDVAKKRSGFGDKGTPCGSYGIAGEITVTTANVRRAET
Download sequence
Identical sequences XP_004273795.1.21590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]