SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004274447.1.21590 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004274447.1.21590
Domain Number 1 Region: 27-188
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.71e-47
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 243-286
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000419
Family SOCS box-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004274447.1.21590
Sequence length 288
Comment PREDICTED: ankyrin repeat and SOCS box protein 8 isoform X1 [Orcinus orca]; AA=GCF_000331955.2; RF=representative genome; TAX=9733; STAX=9733; NAME=Orcinus orca; AL=Scaffold; RT=Major
Sequence
MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCTHGTLKPLHCA
CMVSDADCVELLLEKGAEVNALDGYNRTALHYAAEKDEACVEVLLEYGANPNALDGNRDT
PLHWAAFKNNAECVRALLESGASVNALDYNNDTPLSWAAMKGNLESISILLDYGAEVRVI
NLKGQTPISRLVALLVRGLGTEKEDSCFELLHRAVGHFELRKNGTMPREVAKDQQLCEKL
TVLCSAPGTLKTLSRYAVRRSLGLQYLPDAVKGLPLPASLKEYLLLVE
Download sequence
Identical sequences XP_004274447.1.21590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]