SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004303144.1.20112 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004303144.1.20112
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.83e-22
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0000907
Further Details:      
 
Domain Number 2 Region: 79-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.92e-18
Family Cold shock DNA-binding domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004303144.1.20112
Sequence length 176
Comment PREDICTED: DNA-directed RNA polymerase II subunit RPB7 [Fragaria vesca subsp. vesca]; AA=GCF_000184155.1; RF=representative genome; TAX=101020; STAX=57918; NAME=Fragaria vesca subsp. vesca; AL=Chromosome; RT=Major
Sequence
MFFHIVLERNMQLHPRHFGRNLRENLVAKLMKDVEGTCSGQHGFVVAITGIENIGKGLIR
DGTGFVSFPVKYQCVVFRPFKGEILEAVVTMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQ
SGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVINDPASV
Download sequence
Identical sequences XP_004303144.1.20112 XP_011466941.1.20112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]