SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004382159.1.4749 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004382159.1.4749
Domain Number 1 Region: 16-120
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 5.36e-34
Family Nucleoplasmin-like core domain 0.0000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004382159.1.4749
Sequence length 211
Comment PREDICTED: nucleoplasmin-2 [Trichechus manatus latirostris]; AA=GCF_000243295.1; RF=representative genome; TAX=127582; STAX=9778; NAME=Trichechus manatus latirostris; AL=Scaffold; RT=Major
Sequence
MSRSSTSSREEKAVTTMLWGCELNQEKRTWTFKPQMEGKQDCKLLLSTICLGEKAKEEMN
LVEILPAYQEDKKTQPITIASLQASILPMVSIMGLELSLPVTFQLRAGSGPVFLSGQECY
ETSDLPWEEEEEEEEEEEEDNEDDDDDEDVSLEEETPVKQVKRPAPQKQMSVTKKKKLEK
EEEAVRSSVKHKSPVRKAKLTPRPKKPGFKK
Download sequence
Identical sequences XP_004382159.1.4749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]