SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004386420.1.4749 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004386420.1.4749
Domain Number 1 Region: 17-240
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.32e-50
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 250-292
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000392
Family SOCS box-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004386420.1.4749
Sequence length 294
Comment PREDICTED: ankyrin repeat and SOCS box protein 9 [Trichechus manatus latirostris]; AA=GCF_000243295.1; RF=representative genome; TAX=127582; STAX=9778; NAME=Trichechus manatus latirostris; AL=Scaffold; RT=Major
Sequence
MDGEEGSRNDSKSLGLGPPPDTRLLSNPLMEDVVSDWSPMHEAAIHGRLLSLRNLISQGW
PVNFVTTDRVSPLHEACLGGHPSCASILLKHGAQVNGLTTDWHTPLFNACVSGSQDCVNL
LLQHGASPDSANDLASPIHEAAKRGHVECVESLAAHGGNIDYNIRHLGTPLYLACENQQI
ACAKKLLESGASANCGKGLDSPLHVVARTCSRELARLLLDFGADTQAKNADGKRPVELVA
PENALTQLLSQREGPPSLMHLCRLRIRKCFGTKQHHKITGLVLPVELKQFLLHI
Download sequence
Identical sequences XP_004386420.1.4749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]