SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004400105.1.74151 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004400105.1.74151
Domain Number 1 Region: 46-189
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.53e-46
Family CRAL/TRIO domain 0.000000138
Further Details:      
 
Domain Number 2 Region: 193-313
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 7.98e-38
Family Supernatant protein factor (SPF), C-terminal domain 0.000000343
Further Details:      
 
Domain Number 3 Region: 2-59
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.96e-16
Family CRAL/TRIO N-terminal domain 0.0000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004400105.1.74151
Sequence length 320
Comment PREDICTED: SEC14-like protein 2 isoform X3 [Odobenus rosmarus divergens]; AA=GCF_000321225.1; RF=representative genome; TAX=9708; STAX=9707; NAME=Odobenus rosmarus divergens; AL=Scaffold; RT=Major
Sequence
MSGRVGDLSPKQKEALAKFRENVQDVLPTLPNPDDYFLLRWLRARNFDLQKSEAMLRKVG
KKVETVTLIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFIVKAPKLFPVAYN
LIKPFLSEDTRKKIMVLGANWKEVLLKYISPDQLPVEYGGTMTDPDGNPKCKSKINYGGD
IPKKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGSDIGFGIFLKTK
MGERQRAGEMTEVLSNQRYNAHLVPEDGTLTCTDPGIYVLRFDNTYSFIHAKKVSFTVEV
LLPDKASEEKMKQLGAVTPK
Download sequence
Identical sequences XP_004400105.1.74151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]