SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004447791.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004447791.1.11602
Domain Number 1 Region: 42-135
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 2.09e-22
Family Supernatant protein factor (SPF), C-terminal domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004447791.1.11602
Sequence length 227
Comment PREDICTED: transmembrane emp24 domain-containing protein 1 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MMAAGAALALALWLLLPPTGVAGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEY
QVIGGAGLDVDFSLESPQGVLLVSEARKADGMHTVEPTEAGDYKLCFDNSFSTISEKLVF
FELIFDSLQEDEEVEGWAEAVEPEEMLDVKMEDIKESIETMRARLERSIQMLTLLRALEA
RDRNLQEGNLERVTFWSAVNVAVLLLVAVAQVCTLKRFFQDKRPVPT
Download sequence
Identical sequences ENSDNOP00000021742 XP_004447791.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]