SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004472430.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004472430.1.11602
Domain Number 1 Region: 128-394
Classification Level Classification E-value
Superfamily vWA-like 8.26e-90
Family Trunk domain of Sec23/24 0.00000066
Further Details:      
 
Domain Number 2 Region: 8-66,411-519
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 4.71e-64
Family beta-sandwich domain of Sec23/24 0.00037
Further Details:      
 
Domain Number 3 Region: 623-763
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 5.23e-56
Family C-terminal, gelsolin-like domain of Sec23/24 0.0000063
Further Details:      
 
Domain Number 4 Region: 520-622
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 6.8e-46
Family Helical domain of Sec23/24 0.00000791
Further Details:      
 
Domain Number 5 Region: 49-123
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.24e-21
Family Zn-finger domain of Sec23/24 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004472430.1.11602
Sequence length 767
Comment PREDICTED: protein transport protein Sec23B [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MTTYLEFIHQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVL
CSRPTCKAILNPLCQVDYRAKLWACNFCFQRNQFPPAYAGISEVNQPAELMPQFSTIEYV
IQRGPQTPLIFLYVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLVTFGRMVQVHELSC
EGISKSYVFRGTKDLTAKQIQDMLGLTKPTMPMQQARPSQPQEHPFVSSSFLQPIHKIDM
NLTDLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLEGTFPNTGARIMLFTGGPPTQGP
GMVVGDELKTPIRSWHDIEKDNARFMKKATKHYEMLANRTAANGHCIDIYACALDQTGLL
EMKCCTNLTGGHMVMGDSFNTSLFKQTFQRIFSKDFNGDFRMAFGATLEVKTSRELKIAG
AIGPCVSLNVKGPCVSENELGVGGTSQWKVCGLDPTSTLGIYFEVVNQHNAPIPQGGRGA
IQFVTQYQHSSTQRRIRVTTIARNWADAQSQLKHIEAAFDQEAAAVLMARLGVFRAESEE
GPDVLRWLDRQLIRLCQKFGQYNKEDPTSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPD
ESSYYRHHFARQDLTQSLIMIQPILYSYSFHGPPEPVLLDSSSILADRILLMDTFFQIVI
YLGETIAQWRKAGYQDMPEYENFKHLLQAPLDDAQEILQARFPMPRYINTEHGGSQARFL
LSKVNPSQTHNNLYAWGQETGAPILTDDVSLQVFMDHLKKLAVSSAC
Download sequence
Identical sequences ENSDNOP00000012012 XP_004472430.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]