SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004542439.1.88231 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004542439.1.88231
Domain Number 1 Region: 119-390
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-67
Family Nuclear receptor ligand-binding domain 0.00000762
Further Details:      
 
Domain Number 2 Region: 51-131
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.71e-30
Family Nuclear receptor 0.0000838
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004542439.1.88231
Sequence length 405
Comment PREDICTED: nuclear receptor subfamily 2 group F member 6-like isoform X1 [Maylandia zebra]; AA=GCF_000238955.2; RF=representative genome; TAX=106582; STAX=106582; NAME=Maylandia zebra; ecotype=Mazinzi reef; AL=Scaffold; RT=Major
Sequence
MAMVSGGWGDPNGGTNGLGDKGYLRGEEEDGSPQAGGSDMEAGEDDKACVVDCVVCGDKS
SGKHYGVFTCEGCKSFFKRSVRRNLSYTCRSNRECQIDQHHRNQCQYCRLKKCFRVGMRK
EAVQRGRIPPQPSLSPSITPIGGASGLGGGEFYNNNNGGSGGGQPVSELISQLLRAEPYP
NSRYGHQYNQQAGPDNAMGIDNICELAARLLFSTVEWARNIPYFPELPVSDQVALLRLSW
SELFILSAAQSALPLHMAPLLAAAGFHSSPMSAERVVSFMDQVRVFQDQVDKLTRLQVDS
AEYSCLKAIALFSPDACGLTDPVHVESLQEKAQVALTEYERMQYPSQPQRFGRLLLRLPA
LRAVPASLISQLFFMRLIGKTPIETLIRDMQLSGNSISWPYVPGQ
Download sequence
Identical sequences I3JWG9
ENSONIP00000013214 ENSONIP00000013214 XP_004542439.1.88231 XP_005721099.1.53837 XP_005920731.1.24487 XP_006786822.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]