SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004575647.1.88231 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004575647.1.88231
Domain Number 1 Region: 22-94
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000000589
Family Extracellular domain of cell surface receptors 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004575647.1.88231
Sequence length 117
Comment PREDICTED: CD59 glycoprotein-like [Maylandia zebra]; AA=GCF_000238955.2; RF=representative genome; TAX=106582; STAX=106582; NAME=Maylandia zebra; ecotype=Mazinzi reef; AL=Scaffold; RT=Major
Sequence
MKSTLGICLVICCTLIGLGSAIRCYSCKDYTASCTKERECSYDDACLTLRERGGMTYRQC
MKYSDCEYGRLAQMFPQVSSFTFKCCNSDLCNSAPSSATSSVIGVLASLAVMWWCIH
Download sequence
Identical sequences XP_004575647.1.88231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]