SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004577894.1.84141 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004577894.1.84141
Domain Number 1 Region: 6-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000018
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004577894.1.84141
Sequence length 212
Comment PREDICTED: ropporin-1A [Ochotona princeps]; AA=GCF_000292845.1; RF=representative genome; TAX=9978; STAX=9978; NAME=Ochotona princeps; AL=Scaffold; RT=Major
Sequence
MPQTDKQICIPPELPELLKQFTKAAIRTQPQDLIQWASDYFGAMSRGDVPPVRDPSERVS
LSNWAELTPELLKILHSRVAGRLIIHAEELAQIWKVLNLPTDLFNSVMNVGRFTEEIEWL
KFLALACSSLGVTIAKTLEIVCEVLSCDRDSGPPRIPFSTFQFLYTYIAEVDGEISASHV
SRMLNYIEQEVIGPDGLIKVNDFTQNPRVRLE
Download sequence
Identical sequences ENSOPRP00000009422 ENSOPRP00000009422 XP_004577894.1.84141 XP_012784196.1.84141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]