SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004602993.1.94378 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004602993.1.94378
Domain Number 1 Region: 1-191
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-59
Family SPRY domain 0.0000000342
Further Details:      
 
Domain Number 2 Region: 180-217
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000152
Family SOCS box-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004602993.1.94378
Sequence length 218
Comment PREDICTED: SPRY domain-containing SOCS box protein 4, partial [Sorex araneus]; AA=GCF_000181275.1; RF=representative genome; TAX=42254; STAX=42254; NAME=Sorex araneus; AL=Scaffold; RT=Major
Sequence
WNPEDRSLNVFVKEDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQIHWPARQRGTHAVV
GVATARAPLHSVGYTALVGSDCESWGWDLGRSRLYHDGKNRPGVAYPAFLGPEEAFSLPD
SLLVVLDMDEGTLSFVVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPL
PLMDLCRRSIRLALGRQRLRDISALPLPQSLKNYLQYQ
Download sequence
Identical sequences XP_004602993.1.94378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]