SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004608717.1.94378 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004608717.1.94378
Domain Number 1 Region: 429-565
Classification Level Classification E-value
Superfamily TIMP-like 3.61e-31
Family Netrin-like domain (NTR/C345C module) 0.018
Further Details:      
 
Domain Number 2 Region: 206-301
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-21
Family I set domains 0.048
Further Details:      
 
Domain Number 3 Region: 382-434
Classification Level Classification E-value
Superfamily BPTI-like 2.13e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 4 Region: 321-377
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000908
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.011
Further Details:      
 
Domain Number 5 Region: 120-170
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000129
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 34-85
Classification Level Classification E-value
Superfamily Elafin-like 0.000000109
Family Elafin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004608717.1.94378
Sequence length 573
Comment PREDICTED: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 [Sorex araneus]; AA=GCF_000181275.1; RF=representative genome; TAX=42254; STAX=42254; NAME=Sorex araneus; AL=Scaffold; RT=Major
Sequence
MRGPGGLGLWSRWGQVAVLLLLLGAPPQGLALPPIRYSHAGICPNDMNPNLWVDAQSTCK
RECETDQECETHEKCCPNVCGTRSCVAARYMDVKGRKGPVGMPTEATCDHFTCLQQGSEC
DIWDGQAVCKCKERCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHFTWPH
TSPPPPETTARPTTTSPETPGLDLAAPALLKHPAHQSVTVGETVSFLCDVVGRPRPEVTW
EKQLEDRENVVLRPNHVRGNVVVTNIAQLVIYNAQPQDAGIYTCTARNAAGVLRADFPLS
VVGAGQVPVSVDSGPNGTAFPAAECLQPPDPEDCGEEQTRWHFDAQANNCLTFTSGRCLR
HRNHFDTYEACARACMSGPLALCSLPALQGPCRAYAPRWAYNGQTGQCQSFVYGGCEGNG
NNFESREACEESCPFPRASPRCRACKPRQKLVTSFCRSDFVILGRVSELTEEPDAGRALV
TVDEVLKDEKMGLKFLGQEPLEVTLLHVDWACPCPNVTVGGTPLIIMGEVDGGMAMLRPD
SFVGLSSPRRVRKLREVLQKKTCDLLKEFLGLH
Download sequence
Identical sequences XP_004608717.1.94378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]