SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004706690.1.18182 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004706690.1.18182
Domain Number 1 Region: 7-105
Classification Level Classification E-value
Superfamily SRP19 7.46e-33
Family SRP19 0.00000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004706690.1.18182
Sequence length 116
Comment PREDICTED: signal recognition particle 19 kDa protein [Echinops telfairi]; AA=GCF_000313985.1; RF=representative genome; TAX=9371; STAX=9371; NAME=Echinops telfairi; AL=Scaffold; RT=Major
Sequence
MASAAARSPADQDRFICIYPAYLNNKKTLAEGRRIPVNKAVENPTASEIQDVCLAVGLNV
SLEKNKMYSREWNRDAQYRGRVRVQLKQEDGSLCLVQFPSHCSLLMSSGTSFRILA
Download sequence
Identical sequences XP_004706690.1.18182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]