SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004740042.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004740042.1.14098
Domain Number 1 Region: 7-31,79-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.58e-22
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 140-265
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.06e-21
Family Voltage-gated potassium channels 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004740042.1.14098
Sequence length 499
Comment PREDICTED: potassium channel subfamily K member 5 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKSYYTQKLHLLKEFPCLGQEGLDKI
LQVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGL
FGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRQAQITCTAIFIVWGVLVHLVIPPF
VFMVTEEWDYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQVTGSTASKDINIFGFLSKKEET
YNDLIKQIGKKAMKTSGAGERVPAPGLGPQGGGLPSLPTSLSPLVVYSKNRVPSLEEVSQ
TLRSKGHVSRPPSEEAGAGPPKEGSPTSEVFINQLDRISEEGEPWDAQDYHPLIFQNVSI
TFANEEAGLSDEETSKSSIEDNLAGEERPQEGTEAEAPLNLGEFPSSDESTFTSTESELS
LPYEQLMNEYIQSDCPRGT
Download sequence
Identical sequences M3YQT6
ENSMPUP00000013695 XP_004740042.1.14098 ENSMPUP00000013695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]