SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004744592.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_004744592.1.14098
Domain Number - Region: 48-143
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.00968
Family Supernatant protein factor (SPF), C-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004744592.1.14098
Sequence length 241
Comment PREDICTED: transmembrane emp24 domain-containing protein 6 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MFPLLFGAGLVVLNLVTSAKSQKTEPLSGSGDQLLFHGADRSDFAIMIPPAGTECFWQFA
RQTGYLYFSYEVQRTLGMSHDRHVAATAHTPQGFLIDSSQSVRGQINFSTKETGFYQLCL
KNQQNHFGSVQVYLNFGVFYEGPEMDHKQKNERKQLNDTLDAIEESTRKVQNNIFHMWRY
YNFARMRKMADFFLLQSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPKTTDTKKPR
C
Download sequence
Identical sequences M3Y7G2
ENSMPUP00000007269 ENSMPUP00000007269 XP_004744592.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]