SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004745996.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004745996.1.14098
Domain Number 1 Region: 623-907
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.66e-41
Family C5 cytosine-specific DNA methylase, DCM 0.0063
Further Details:      
 
Domain Number 2 Region: 280-421
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.93e-38
Family PWWP domain 0.0000161
Further Details:      
 
Weak hits

Sequence:  XP_004745996.1.14098
Domain Number - Region: 526-593
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000662
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004745996.1.14098
Sequence length 909
Comment PREDICTED: DNA (cytosine-5)-methyltransferase 3A isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MPSSGPGDTSSSALEREEDRKEGEEQEEARGKEERQEPSTTARKVGRPGRKRKHPPVESS
DTPKDPAVTSKSPSMAQDSGPSELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAE
TPPEASRAVENGCCTPKDGRGAPAEESKEQKETNIESMKMEGSRGRLRGGLGWESSLRQR
PMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAVMNAVEENQGSGESQKVEEAS
PPAVQQPTDPASPTVATTPEPVGADAGDKNATKAADDEPEYEDGRGFGIGELVWGKLRGF
SWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQP
MYRKAIYEVLQVASSRAGKLFPACHDSDESDTAKAVEVQNKQMIEWALGGFQPSGPKGLE
PPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTTEKPKVKEIIDERTRERLVYEV
RQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGG
REVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRRDDWPS
RLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIAS
EVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGL
YEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAK
EVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQG
KDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFA
PLKEYFACV
Download sequence
Identical sequences M3YRH9
ENSMPUP00000013938 XP_004745995.1.14098 XP_004745996.1.14098 ENSMPUP00000013938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]