SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004748763.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004748763.1.14098
Domain Number 1 Region: 5-144
Classification Level Classification E-value
Superfamily ENTH/VHS domain 5.23e-46
Family VHS domain 0.0000584
Further Details:      
 
Domain Number 2 Region: 159-221
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.67e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0003
Further Details:      
 
Weak hits

Sequence:  XP_004748763.1.14098
Domain Number - Region: 414-529
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0146
Family Arfaptin, Rac-binding fragment 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004748763.1.14098
Sequence length 780
Comment PREDICTED: hepatocyte growth factor-regulated tyrosine kinase substrate isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVSSIKKKVNDKNPHV
ALYALEVMESVVKNCGQTVHDEVANKQTMEELKELLKRQAEVNVRNKILYLIQAWAHAFR
NEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKH
HCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNKKAEGKASSTTELPPEYLTS
PLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERMRQKSAYAAATYPKAEPAPVA
SSAPPASSLYSSPVTSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPAPLTEPA
APPAEGHAVPASALETPLPETDAQPVAPSSGPFGEQYQNGESEESHAQFLKALQNAVTTF
VNRMKSNHVRGRSITNDSAVLSLFQSINGMHPRLLELLNQLDERRLYYEGLQDKLAQIRD
ARGALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAVQRLREQ
EQERQLRLEQQKQTVQMRAQMPAFSLPYAQLQAMPAAGGVLYQPSGPTSFPGTFSPAGSV
EGSPMHTVYMSQPAAAASTPYPSMPGAATDPGMVGAYMYPAGATSAQAAPQGPAGPTASP
AYSSYQPTPTQAYQNVASRAPQSLPAVSQPPQSGAMGYMGSQSVSIGYQPYGMQSLMNTL
PSQDAPLPPPQQPYIAGQQPLYQQMAPSGGPPQQQPPVAQPPPAQGPPAQGSEAQLISFD
Download sequence
Identical sequences M3YJ42
ENSMPUP00000011349 ENSMPUP00000011349 XP_004748763.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]