SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004754880.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004754880.1.14098
Domain Number 1 Region: 570-681
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.6e-24
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 711-783
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.37e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 162-306
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.1e-17
Family G proteins 0.014
Further Details:      
 
Domain Number 4 Region: 34-127,431-480,614-636
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000479
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004754880.1.14098
Sequence length 787
Comment PREDICTED: zinc finger FYVE domain-containing protein 1 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MVGDFLANLSMSAQTSPAEKGLNPGLMCQESYACSGTDEAVFECDECCSLQCLRCEEELH
RQERLRNHERIRLKPGHVPYCDPCKGTNGHSPGVRQRAAVRCQTCKINLCLECQKRTHSG
GNKRRHPVTVYHVTKVQGLLEEDELDEETRRKKMTEKVVSFLLVDENEEIQVTNEEDFIR
KLDCKPDQHLKVVSIFGNTGDGKSHTLNHTFFYGREVFKTSPAQESCTVGVWAAYDPVHK
VAVIDTEGLLGATVNLSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFLGDASEAYLKH
FTKELKATTARCGLDVPLSTLGPAVIIFHETVHTQLLGSDHPSEVPEKLIQDRFRKLGRF
PEAFSSIHYKGTRTYNPPTDFSGLRRALEQQLENNTTRSPRHPGVIFKALKALSDRFSGE
IPDDQMAHSSFFPDEYFTCSSLCLSCGAGCKNSMNHGKEGVPHEAKSRCRYSHQYDNRVY
TCKACYERGKEVSVVPKTSASTDSPWMGLAKYAWSGYVIECPNCGVVYRSRQYWFGNQDP
VDTVVRTEIVHVWPGTDGFLKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQI
APAYWRPNSQILSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRV
CDNCYEARNVQLDVTEAQADDEGGTLIARKVGEAVQSTLGAVVTAIDIPLGLVKDAARPA
YWVPDHEILHCHSCRKEFSIKLSKHHCRACGQGFCDECSHDRRAVPSRGWDHPVRVCFNC
NKKPGDL
Download sequence
Identical sequences M3XX60
ENSMPUP00000003660 XP_004754880.1.14098 XP_004754881.1.14098 ENSMPUP00000003660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]