SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004758014.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004758014.1.14098
Domain Number 1 Region: 838-923
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.32e-18
Family PHD domain 0.0027
Further Details:      
 
Weak hits

Sequence:  XP_004758014.1.14098
Domain Number - Region: 14-73
Classification Level Classification E-value
Superfamily Histone-fold 0.00848
Family Archaeal histone 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004758014.1.14098
Sequence length 934
Comment PREDICTED: transcription initiation factor TFIID subunit 3 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTD
PILDDVGEAFQLMGVSLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEER
KEYIPDYMPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEGDDELEEEEIINDENFLGKRP
LDSPEAEEMPAIKRPRLLSTKGDTLDVVVLEAREPLSSINTQKIPPMLSPVHAQDSADLA
PPSPEPPMLAPVAKSQMPITKPLETKSFTPKTKTKTSSPGQKTKSPKTTQSPAMVGSPIR
SPKTISKEKKSPGRSKSPKSPKSPKVMTHTPQVPVRPETPNRTPSAMISEKLSKDTIQVK
QIQTPPDPGKLNNENQPKKAVVTDRTIDDSINAVIARACAEREPDPFEFSSGSESEGDIF
TSPKRISGSECTTPKASTSSNNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLG
APPAMPPAFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQR
DKERERDRSKEKSKEKDKGKDKDKDKDKEGGKETKYPWKELLKDEEPDPYKLKIREFEDV
DPKVRLKDGIVRKEREKHKDKKKDRDRGRRDRDKRDRERVKEKGRDERPRVAPGPLVLPP
KDAPLPLFSPAAAARVPSALPPLSSVLPEKLFEDKEKPKERERKKDKKEKKKKKEKEKEK
EKKDREREREKREREKREREKDKHRHEKIKVEPVVPAPSPVIPRLTLRVGAGQDKIVISK
VVPAPEAKPAPSLSRPKTPPPAAAPTPVPMHVAPAPVPSPLLTQSAVAPALMPAPSPAVS
GAGTSKAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCV
GIMAAPPEEMQWFCPKCANKKKDKKHKKRKHRAH
Download sequence
Identical sequences M3YY76
ENSMPUP00000016286 XP_004758014.1.14098 ENSMPUP00000016286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]