SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004767146.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004767146.1.14098
Domain Number 1 Region: 583-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000414
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 620-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000139
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 90-120
Classification Level Classification E-value
Superfamily SET domain 0.0000085
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 132-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000809
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004767146.1.14098
Sequence length 718
Comment PREDICTED: PR domain zinc finger protein 13 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MHGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPRKKVRMVRGELVDES
GGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFD
IPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVLSSGGSRAYLHHEHAARQG
AAPAADGLHFAPKPPAPDFAAAAPAGPLRSHPHAPPPLQACGARESIKREASSAPSAPSP
PPAKWGQSKKGKEQPDRALDMSGASRGHGHFLGFVGGSPARGGGLAFYPGVRSAFKPAGL
ARAAAAAAHGDPYREEGGGKPGSGLALGRLLGGGRAGGRPGSGENPAAGSTGHHHHHHAH
HHHHHSKCLLAGEPPPPPPPGLPCSGGLRGFPLLPGPPEEASAFKHVERAQPAAAALPGA
RFAQLPSATGLPVERCALPALDAGGLKAYPGGECSHLPAVMPAFTVYNGELLYGSPAAAA
YYPLKLHFGGLLKYPESFSYFSGPAAAAAAAAGAAALSPAELGSLASIDREIAMHTQQLS
EMAAGKSRGRLDAGTLPPAVVATGGPGGGGSGGGGAGKPKTGHLCLYCGKLYSRKYGLKI
HMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVK
SRHPGQNLLAKAGEGPGAEPDYLPEPGEPKSDNDSDVDVCFTDDQSDPEAGGGGERNS
Download sequence
Identical sequences M3XRD1
XP_004767146.1.14098 ENSMPUP00000001631 ENSMPUP00000001631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]