SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004777231.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004777231.1.14098
Domain Number 1 Region: 348-482
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.05e-36
Family Synaptotagmin-like (S variant) 0.00085
Further Details:      
 
Domain Number 2 Region: 493-634
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.84e-33
Family Synaptotagmin-like (S variant) 0.0023
Further Details:      
 
Domain Number 3 Region: 8-129
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.88e-27
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004777231.1.14098
Sequence length 671
Comment PREDICTED: synaptotagmin-like protein 4 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MSEILDLSFLSEVERDLILSVLQRDEELRKADEKRIRRLKNELLEIKRKGAKRGSQHYSD
RTCARCQESLGRLTPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCTKEIELKKATGDWFY
DQKVNRFAYHTGSEIIRMSLRRKPTVNKRETLGQSLLPQSQMDDIWPGRRIIQEQQKEPS
VLFEVPKPKSGRSALEAESESLDSYTADSDSLTRRDSLDKSGLFPEWKKMSAPASQVEKE
TQPGGQNVVSIDEGEMIFKKNTRKILRPSEYTKSVIDLRPEDVGHENGSLGDRSKSVPGL
SVDMEEEEEEEDIDHLVKLHRQKLARSSMRSGSSMSTIGSMTSIYSEAGDFGNIFVTGKI
AFSLKYEQQTQTLVIHVKECHQLAYADEAKKHSNPYVKTYLLPDKSRQGKRKTSIKRNTI
NPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEVQMDSWKLDKKLDHCLPL
HGKISAESLTGLPSHKGELVVSLKYIPASKLPVGGDRKKSKGGEGGELQVWIKEAKNLTA
AKSGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELT
VWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLHL
RSSMAKQKLGL
Download sequence
Identical sequences M3XTC1
ENSMPUP00000002321 ENSMPUP00000002321 XP_004777230.1.14098 XP_004777231.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]