SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004841198.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004841198.1.39548
Domain Number 1 Region: 13-213
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.52e-24
Family Protein-L-isoaspartyl O-methyltransferase 0.003
Further Details:      
 
Weak hits

Sequence:  XP_004841198.1.39548
Domain Number - Region: 239-261
Classification Level Classification E-value
Superfamily SOCS box-like 0.0602
Family SOCS box-like 0.014
Further Details:      
 
Domain Number - Region: 340-358
Classification Level Classification E-value
Superfamily SOCS box-like 0.0876
Family SOCS box-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004841198.1.39548
Sequence length 360
Comment PREDICTED: protein-L-isoaspartate O-methyltransferase domain-containing protein 2 isoform X2 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MGGAVSAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHGN
IHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEY
AKQKLDFFIRTSDSFDKFDFCEPSFVTGNCLEISPDCSQYDRVYCGAGVQKEHEEYMKNL
LKVGGILVMPLEEKLTKITRTGPSAWETKKILAVSFAPLIQPCHSESGKSRLVQLPPLAV
RSLQDLARIAIRRAIKKIIHQESLSKSGNGLKNTPRFKRRRIRRRQMETIVFLDKEVFAS
RISNPSEDNSCEDLEEERREEEKTSAESKPDPPVNFLRQKVLSLPLPDPLKYYLLYYREK
Download sequence
Identical sequences G5C8A3
XP_004841197.1.39548 XP_004841198.1.39548 HGL_H00000307854-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]