SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004841845.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004841845.1.39548
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily SRP19 3.01e-39
Family SRP19 0.000000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004841845.1.39548
Sequence length 144
Comment PREDICTED: signal recognition particle 19 kDa protein isoform X1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNA
FLEKNKMYSREWNRDIQYRGRVRVQLKQEDGSLCLGQFPSRKSVMLYAAEMIPKLKTRTQ
KTGGGDPNLQQGEGSKKGKGKKKK
Download sequence
Identical sequences G5BA33
XP_004841845.1.39548 HGL_H00000282999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]