SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004843537.1.39548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004843537.1.39548
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-21
Family Kringle modules 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004843537.1.39548
Sequence length 263
Comment PREDICTED: phosphoinositide-3-kinase-interacting protein 1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence
MLLAWVQTFFLSNMLLAEAYGSGGCFWDHGHLYREDQPSPAPGLRCLNWLDAQGGLGSAL
ELGYGNHNYCRNPDRDPRGPWCYVSGEAGTPEKVPCQDARCPETTSQAPPAFTTEPEEMS
EVPGDDEVQVFAPANTLPVRSEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVI
IIAIGAGIILGYTYKRGKDLKEQHDQKVCEREMQRITLPLSAFTNPTCEIVDERTVVVHS
NQTPVDLQEGSTPLIGEAGTPGA
Download sequence
Identical sequences G5BBU8
HGL_H00000215912 XP_004843537.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]